PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0029700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 332aa    MW: 37625.2 Da    PI: 9.5459
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0029700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65e-092512852155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  Spipo5G0029700 251 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 285
                     569*****************************885 PP

2ELK38.42.5e-13205226122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLg+LkqEF+
  Spipo5G0029700 205 ELKGQLLRKYSGYLGGLKQEFL 226
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-786135IPR005540KNOX1
PfamPF037908.0E-1488112IPR005540KNOX1
PfamPF037897.5E-10205226IPR005539ELK domain
SMARTSM011883.9E-7205226IPR005539ELK domain
PROSITE profilePS5121310.877205225IPR005539ELK domain
PROSITE profilePS5007112.795225288IPR001356Homeobox domain
SMARTSM003891.5E-12227292IPR001356Homeobox domain
SuperFamilySSF466894.28E-19227295IPR009057Homeodomain-like
CDDcd000861.07E-13228288No hitNo description
Gene3DG3DSA:1.10.10.608.5E-28230291IPR009057Homeodomain-like
PfamPF059206.5E-17245284IPR008422Homeobox KN domain
PROSITE patternPS000270263286IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEGLSSSGVM GFAEGGGSGG LSPLMIMPLM ASQPASAEHN LLFLPPPTNH HHAGGSKGNH  60
HRQNTENNNV RYPSSYPSAM DEKDRINMKA KIMCHPHYPR LLSAYVNCHK VGKAKEEDEG  120
RCLGFVDEKM KRWEGDRVDD QRGISRSLLS KIDLRILCQT WKCQHLRSLV ILFPMGMSSW  180
PGVISVTAMA MELECDCGWA LQDRELKGQL LRKYSGYLGG LKQEFLKRRK KGKLPKEARY  240
QLLDWWNRHY KWPYPSESQK LALAESTGLD QKQINNWFIN QRKRHWKPAE EMQFVAAAAE  300
AGRPHYYLDN PLGSPFSVGF GPPFSEVQRP M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444605.13e-82PREDICTED: homeobox protein SBH1-like
SwissprotP466082e-64HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0D2TLX03e-82A0A0D2TLX0_G
STRINGVIT_12s0059g01190.t018e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2107357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.13e-62KNOX/ELK homeobox transcription factor